PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.ZG61K
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 293aa    MW: 33201.4 Da    PI: 8.9486
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.ZG61KgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.56.2e-334094155
      G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                 kprlrWt++LH+rFv+av++LGG++kAtPk++l++m++kgLtl+h+kSHLQkYRl
  Araip.ZG61K 40 KPRLRWTTDLHDRFVDAVTKLGGPDKATPKSVLRIMGLKGLTLYHLKSHLQKYRL 94
                 79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.2553797IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.4E-323795IPR009057Homeodomain-like
SuperFamilySSF466894.12E-163997IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-244095IPR006447Myb domain, plants
PfamPF002492.2E-84293IPR001005SANT/Myb domain
PfamPF143793.1E-23138184IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
DCCFYCGVER RIVMGSSYGG GIGGGEGGYG VVMSMTREPK PRLRWTTDLH DRFVDAVTKL  60
GGPDKATPKS VLRIMGLKGL TLYHLKSHLQ KYRLGQQAKK QNEEHHKENN RYSYVNFSNS  120
SSEFSTSFRG DNEKGEIPIA EALRHQIEVQ KRLEEQLEVQ KKLQMRIEAQ GKYLQAVLEK  180
AQRTLSMEGS GNNLEASRAQ LTEFNSALSN FMENMNNKDN KQSILDMNDF YSKVHSSGFH  240
NYHEVIRREK NIDQKPKIEE GSIQFDLNSK GSYDLVSGGG GSEIEAKMLS YRL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00544DAPTransfer from AT5G45580Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016200582.10.0PREDICTED: myb family transcription factor APL
SwissprotQ9SAK53e-52APL_ARATH; Myb family transcription factor APL
TrEMBLV7CLJ11e-148V7CLJ1_PHAVU; Uncharacterized protein
STRINGGLYMA01G01300.11e-144(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF51013142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45580.15e-74G2-like family protein